compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

Clover1.5

Clover1.5 is a fluorescent protein published in 2016, derived from Aequorea victoria.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization	Organism	Molecular Weight	Cofactor
?	Aequorea victoria	26.8 kDa	-

FPbase ID: 1S3QB

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

Clover1.5 Sequence

BLAST

Clover1.5 was derived from Clover with the following mutations: N150YN149Y
amino acid numbers relative to CloveravGFP. show relative to avGFP show relative to Clover

MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTFGYGVACFSRYPDHMKQHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHYVYITADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSHQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for Clover1.5
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Improving brightness and photostability of green and red fluorescent proteins for live cell imaging and FRET reporting

Bajar Bt, Wang Es, Lam Aj, Kim Bb, Jacobs Cl, Howe Es, Davidson Mw, Lin Mz, Chu J

(2016). Scientific Reports, 6(1) , 20889. doi: 10.1038/srep20889. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for Clover1.5
Search RIKEN BRC for Clover1.5

Change history

Something missing or incorrect? Submit a change Submit a change