compare

Comparison List

mARs1

mARs1 is a basic (constitutively fluorescent) red fluorescent protein published in 2023, derived from Galaxea fascicularis.
+
Oligomerization Organism Molecular Weight Cofactor
Monomer Galaxea fascicularis 24.9 kDa -

FPbase ID: A6URG

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
571 598 27,100 0.26 7.05      

Photostability

No photostability measurements available ... add one!

mARs1 Sequence

MVSVIKEEMKIRLRMEGTVNGHNFVIEGEGKGNPYEGTQTLDCKVTEGGPLPFAYDILSPQFMYGSKPFIKYPADIPDYFKQSYPEGQHWERVMTYEDGGVCTATQNSSLRGDCFFYDVRFDGTNFPPNGPVMQKKTLGWVPSSEKMYVRDGVLKGDVSKALLLEGGGHYRCDFKTTYKAKKDVRLPGAHKVDHRIEILKHDKDYNNVKLYEIAVARYS

Excerpts

No excerpts have been added for mARs1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Red fluorescent proteins engineered from green fluorescent proteins

Imamura H, Otsubo S, Nishida M, Takekawa N, Imada K

(2023). Proceedings of the National Academy of Sciences, 120(45) , e2307687120. doi: 10.1073/pnas.2307687120. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change