compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

G3GFP

a.k.a. GFP in vector pgwb552

This protein has unmoderated changes.

G3GFP is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2014.

No spectrum has been submitted ... add a spectrum!

Oligomerization	Organism	Molecular Weight	Cofactor
?	<add one>	26.9 kDa	-

FPbase ID: QGJWB

Attributes

Ex λ	Em λ	EC (M^-1 cm^-1)	QY	Brightness	pKa	Maturation (min)	Lifetime (ns)
520	650

Edit States/Attributes

Photostability

No photostability measurements available ... add one!

G3GFP Sequence

BLAST

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFAYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Excerpts

No excerpts have been added for G3GFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Improved Gateway Binary Vectors: High-Performance Vectors for Creation of Fusion Constructs in Transgenic Analysis of Plants

Nakagawa T, Suzuki T, Murata S, Nakamura S, Hino T, Maeo K, Tabata R, Kawai T, Tanaka K, Niwa Y, Watanabe Y, Nakamura K, Kimura T, Ishiguro S

(2014). Bioscience, Biotechnology, and Biochemistry, 71(8) , 2095-2100. doi: 10.1271/bbb.70216. Article Pubmed

Additional References

No additional references have been added.

External Resources

Search Addgene for G3GFP
Search RIKEN BRC for G3GFP

Change history

Something missing or incorrect? Submit a change Submit a change